Protein Info for DZA65_RS06580 in Dickeya dianthicola ME23

Annotation: DNA polymerase III subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR01128: DNA polymerase III, delta subunit" amino acids 20 to 332 (313 residues), 339.1 bits, see alignment E=1.3e-105 PF06144: DNA_pol3_delta" amino acids 21 to 190 (170 residues), 139.9 bits, see alignment E=1.1e-44 PF14840: DNA_pol3_delt_C" amino acids 214 to 338 (125 residues), 237.9 bits, see alignment E=4e-75 PF21694: DNA_pol3_delta_C" amino acids 215 to 318 (104 residues), 28.3 bits, see alignment E=2.3e-10

Best Hits

Swiss-Prot: 72% identical to HOLA_ECOLI: DNA polymerase III subunit delta (holA) from Escherichia coli (strain K12)

KEGG orthology group: K02340, DNA polymerase III subunit delta [EC: 2.7.7.7] (inferred from 98% identity to ddd:Dda3937_02479)

MetaCyc: 72% identical to DNA polymerase III subunit delta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III delta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XX17 at UniProt or InterPro

Protein Sequence (343 amino acids)

>DZA65_RS06580 DNA polymerase III subunit delta (Dickeya dianthicola ME23)
MIRIYPEQLTAQLHEGLRGCYLLFGNEPLLLQESQDQIRTIARQQDFLEHFSFTLDNNTD
WDAIFSTCQALSLFASRQTLLLMLPDAGPGAPAGEQLVKLTTLLHPDILLMVRGNKLTKA
QENSAWFKALSQQGVYVPCMTPEQEQLPRWVAQRAKNMKLELDDAASQLICYCYEGNLLA
LVQALERLSLLYPDGKLTLPRVEQAVNDAAHFTPFHWLDALLGGKSKRAWHILQQLRLEE
CEPVILLRTVQRELLLLLQLKRHMATTPLRTLLDQHKVWQNRRPLLTQALQRLSLTQLQQ
AITLLSRLEITLKQNYGQPVWAELETLSMILCGKALPDGLLEV