Protein Info for DZA65_RS06550 in Dickeya dianthicola ME23

Annotation: endolytic peptidoglycan transglycosylase RlpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03330: DPBB_1" amino acids 78 to 165 (88 residues), 78 bits, see alignment E=5.2e-26 TIGR00413: rare lipoprotein A" amino acids 79 to 178 (100 residues), 105.4 bits, see alignment E=2e-34 PF05036: SPOR" amino acids 310 to 380 (71 residues), 49.5 bits, see alignment E=4.5e-17

Best Hits

Swiss-Prot: 52% identical to RLPA_SALTY: Endolytic peptidoglycan transglycosylase RlpA (rlpA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03642, rare lipoprotein A (inferred from 93% identity to ddd:Dda3937_02485)

Predicted SEED Role

"Rare lipoprotein A precursor" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYD7 at UniProt or InterPro

Protein Sequence (387 amino acids)

>DZA65_RS06550 endolytic peptidoglycan transglycosylase RlpA (Dickeya dianthicola ME23)
MRKDWVWVGAISLALAGCAVTEQPQSSSPQATAYNGPVEEIGGAEPRYEPYKPANMQDYG
MNGKTYHIVKNPENFSESGFATWHDRESVGNRTATGEEFDVNAMSAAHPTLPIPSYVRVT
NLSNGRRLVVRINDRGPYTPGRIIDLTKGAADRLNLSNNTKVKVDFISVAPDGSLSGPGT
IGTRVAKQSFALPSRPTLGSSGLGTPVMESAPATAAAARPISNATLTPAADNGGSNIVSG
NPSVSNTGVSNGGGFLGAPKPLPSGVLEGSEPTSAAAPVRATAITPAVAAAPVAVQPSRT
LSQPAVPAGAGNIVVQVGALSDQQRAQTWLKSLNERFRVPGKVTLNNGLYRIQLGPFQSR
QHAADLQQRLSSEAQQPSFITTVSGAQ