Protein Info for DZA65_RS06505 in Dickeya dianthicola ME23

Annotation: ArsC family reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 TIGR01617: transcriptional regulator, Spx/MgsR family" amino acids 3 to 115 (113 residues), 118.2 bits, see alignment E=1.1e-38 PF03960: ArsC" amino acids 6 to 115 (110 residues), 75.7 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 66% identical to YFFB_ECOLI: Protein YffB (yffB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_02498)

Predicted SEED Role

"FIG138056: a glutathione-dependent thiol reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CW37 at UniProt or InterPro

Protein Sequence (127 amino acids)

>DZA65_RS06505 ArsC family reductase (Dickeya dianthicola ME23)
MAIILYGIKNCDTIKKARRWLEDHQINYRFHDYRVDGLEGQRLQSFIDRMGWQPLLNTRG
TTWRKLEEAYRNTINNEATAKAVMLEQPALIKRPLLVADDGKTLLGFSDDSYQHFFTENT
SHVLPGN