Protein Info for DZA65_RS06480 in Dickeya dianthicola ME23

Annotation: tRNA(Met) cytidine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08351: TmcA_N
  • amino acids 56 to 146 (91 residues), 30.4 bits, E=1.2e-10
• PF05127: Helicase_RecD
  • amino acids 195 to 341 (147 residues), 134.2 bits, E=1.7e-42
• PF13718: GNAT_acetyltr_2
  • amino acids 377 to 484 (108 residues), 30.4 bits, E=9.3e-11
  • amino acids 487 to 541 (55 residues), 27.7 bits, 6.1e-10
• PF13673: Acetyltransf_10
  • amino acids 460 to 519 (60 residues), 23.9 bits, 1.2e-08
• PF00583: Acetyltransf_1
  • amino acids 463 to 517 (55 residues), 24.1 bits, 1.3e-08
• PF17176: tRNA_bind_3
  • amino acids 545 to 662 (118 residues), 136.6 bits, E=1.8e-43

Best Hits

Swiss-Prot: 55% identical to TMCA_YERPD: tRNA(Met) cytidine acetyltransferase TmcA (tmcA) from Yersinia pestis (strain D106004)

KEGG orthology group: K06957, tRNA(Met) cytidine acetyltransferase [EC: 2.3.1.-] (inferred from 92% identity to ddd:Dda3937_02503)

Predicted SEED Role

"Predicted P-loop ATPase fused to an acetyltransferase COG1444"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A0A385XWZ7 at UniProt or InterPro

Protein Sequence (673 amino acids)

>DZA65_RS06480 tRNA(Met) cytidine acetyltransferase (Dickeya dianthicola ME23)
MESFVVSQQYQQRYGIRRLLVLSGRSDWCCAQAQRLSDSLPGDWLWVSASAPQGVTAIPP
RNVRGVLGREFLHAVFDARDGLDAQALAMLVGALRAGSWLLLLAPEWDRWPDCPDADSLR
WSEQPEPIATPRFIRHVQHQLLTDDEVVLWRQPDAEPVIALPHRRSDWLPATGEATSCQQ
AILRQLQHTSCAVSVITAPRGRGKSTLAGMLARQCQGVCWVSAPSRAAGEILLRQAGDAA
AFWAPDALLALCRQHGAPPVEWLLIDEAAAIPAPVLQALLPFFRRVVMTTTVHGYEGTGR
GFLLKFCASLPDWQAIELTAPLRWAEQDPLENIVDQVMLFDAEKQVPERLPGPPAIRLER
RDDWLMSQPERLAGCYGLLCSAHYRTSPLDLRRLLDAPGMHIASACVEEQVGGVIWLVDE
GGLPQTLAQDIWAGRRRPRGNLVAQSLAAHGNQWQAPVLRSRRISRIAVLAAQRGQGIGQ
VLVQEQQQRAQQEQLDFLSVSFGFQPALWRFWQRCGFQLARIGSHIDASSGCYSAMALLP
LSEAGNALAASAHHELLRDWFWLRRDIPVALNLPLMEDQTLTAEDWRNLVGFAMAHRPPE
ACQGALSRLMMRSPMALIGLRLWLEQGRSVAECVHLLQLAGRKALVQRWRSETVQALRQR
DETAWKHWHDTVL