Protein Info for DZA65_RS06475 in Dickeya dianthicola ME23

Annotation: DUF441 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 53 to 71 (19 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 115 to 147 (33 residues), see Phobius details PF04284: DUF441" amino acids 9 to 147 (139 residues), 153.6 bits, see alignment E=1.7e-49

Best Hits

Swiss-Prot: 95% identical to Y2981_DICC1: UPF0756 membrane protein Dd1591_2981 (Dd1591_2981) from Dickeya chrysanthemi (strain Ech1591)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_02504)

Predicted SEED Role

"Putative membrane protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DA57 at UniProt or InterPro

Protein Sequence (150 amino acids)

>DZA65_RS06475 DUF441 domain-containing protein (Dickeya dianthicola ME23)
MAFFDPTLLILLALAALGIISQNMTVTLAILFLVVVRITPLNHYFPWVEKYGLSFGILVL
TIGVMAPIASGKISAGDVFSSFLHWKSLLAVAIGVAVSWLGGRGVTLMSHQPSVVAGLLV
GTVMGVALFRGVPVGPLIAAGLLSLLIGKG