Protein Info for DZA65_RS06380 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 69 to 95 (27 residues), see Phobius details amino acids 103 to 131 (29 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 215 to 230 (16 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 69 to 163 (95 residues), 89.7 bits, see alignment E=7.4e-30 PF00528: BPD_transp_1" amino acids 88 to 268 (181 residues), 82.5 bits, see alignment E=1.6e-27

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 96% identity to ddd:Dda3937_01796)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CGD1 at UniProt or InterPro

Protein Sequence (281 amino acids)

>DZA65_RS06380 amino acid ABC transporter permease (Dickeya dianthicola ME23)
MSRSSAETPSHLPPAPERAGFGFRLRASLTWLVLLSLLLWLFSFMDLDTGLIRQKLPSML
GMHLSPDGFIQGAVLSVVITVISMLFCIVLAVITAAGRLSSSAIAFGCATFYVSLFRGTP
LLVQVLIIYLALPQVGIVMSAFASGIIALSLNYGAYLAETIRSGVLAVPRGQKEAAMALG
LSRWVITTHVVAPQALRIIIPPAGSQFISMIKDSSLVSLMGLWELNFLAQSYGRSTYHYM
EMLTTAAVIYWLLSIGLELLQGRLERRFGRGYEHHDGKKPS