Protein Info for DZA65_RS06375 in Dickeya dianthicola ME23

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 77 to 309 (233 residues), 72.6 bits, see alignment E=1.8e-24

Best Hits

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 94% identity to ddd:Dda3937_01795)

Predicted SEED Role

"Periplasmic binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CYD8 at UniProt or InterPro

Protein Sequence (369 amino acids)

>DZA65_RS06375 ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MRIVFLLLAALWFSPLAQAKTVTDITGRQVAIPDNPQRIVLGESRILYTLALLEPGNPAQ
RVVGWPGDLARYDAQSWGRYTAKFPDIARIPQLGNGNLNSVNAEALLPLKPDLVILPRLA
KGTDNEQSIQQALTQAGIPYIYVDLRVDLLKNTVPSLRLLGDVLNQSSRADAFISFYQQH
MDTIKARLAQYQGRKTTVMLHLHLGRRDTCCTTAVNGNLGELLAFAGGDNIAAGKVKGVY
GELSPEQALAARPDVYIATGMAGPDGKRLSDLMLGPDVTPRQAGDSFRTLLMQEPLLSHL
SAVGTGRAWSMWHNFYLSPYHVVMVEMFAKALYPTLFGDIDPQRTLQQLYQQFLSIDFSG
TYWSQLTHE