Protein Info for DZA65_RS06275 in Dickeya dianthicola ME23

Annotation: transcriptional regulator RcsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00072: Response_reg" amino acids 6 to 120 (115 residues), 76.8 bits, see alignment E=1.5e-25 PF00196: GerE" amino acids 150 to 202 (53 residues), 43.7 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 92% identical to RCSB_SALTY: Transcriptional regulatory protein RcsB (rcsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07687, two-component system, NarL family, captular synthesis response regulator RcsB (inferred from 99% identity to dze:Dd1591_3017)

Predicted SEED Role

"DNA-binding capsular synthesis response regulator RcsB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DJX5 at UniProt or InterPro

Protein Sequence (216 amino acids)

>DZA65_RS06275 transcriptional regulator RcsB (Dickeya dianthicola ME23)
MSNLNVIIADDHPIVLFGIKKSLEQIEWVNVVGEFEDSTALINHLPKLDANVLITDLSMP
GDKYGDGITLIKYIKRHFPHLSIIVLTMNNNPAILSAVLELDIEGIVLKQGAPTDLPKAL
AALQKGKKFTPESVSKVLEKISASGYGDKRLSPKESEVLRLFAEGFLVTEIARKLNRSIK
TISSQKKSAMTKLGVDNDIALLNYLSSVGVSASDKE