Protein Info for DZA65_RS06245 in Dickeya dianthicola ME23

Annotation: 2Fe-2S ferredoxin-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 86 PF00111: Fer2" amino acids 11 to 78 (68 residues), 43.4 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 64% identical to YFAE_ECOLI: Uncharacterized ferredoxin-like protein YfaE (yfaE) from Escherichia coli (strain K12)

KEGG orthology group: K11107, ferredoxin (inferred from 91% identity to ddc:Dd586_1077)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZJ1 at UniProt or InterPro

Protein Sequence (86 amino acids)

>DZA65_RS06245 2Fe-2S ferredoxin-like protein (Dickeya dianthicola ME23)
MTAYTVTLRLSGAQLLCSDEHTSLLEVLESQQVPVEYQCRSGYCGACRLRLTKGQVAYRE
TPLACLQRGEILPCCCMPLDDIELDM