Protein Info for DZA65_RS06205 in Dickeya dianthicola ME23

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 185 to 206 (22 residues), see Phobius details PF08269: dCache_2" amino acids 38 to 186 (149 residues), 100.2 bits, see alignment E=2.5e-32 PF17200: sCache_2" amino acids 39 to 181 (143 residues), 133.7 bits, see alignment E=1e-42 PF17201: Cache_3-Cache_2" amino acids 67 to 180 (114 residues), 45.2 bits, see alignment E=1.5e-15 PF00015: MCPsignal" amino acids 324 to 479 (156 residues), 171.4 bits, see alignment E=3.2e-54

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 94% identity to ddd:Dda3937_03899)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUU5 at UniProt or InterPro

Protein Sequence (528 amino acids)

>DZA65_RS06205 methyl-accepting chemotaxis protein (Dickeya dianthicola ME23)
MKISLARRLWFPLIISLLCLAGTLLYGSVKVKQDQLSLRKSELMHVTQLALGVVKTNAEQ
ASNGVISQSEAQQRAMKAIKDLRYGDSGYFTILNSQARVLMHPINEKLIGQGEDFKDANG
VYLFREMVTVTRDSQSGYTVYAFPRPGATVAQPKVAYNSLYAPWDWIITTGLYVDDINEA
FIYSLYQNVIVFVLISVVLLFFAYCINRGILRILGGEPTYAAEVAARIAAGNLSYPVTTL
PGDKVSLLHEMGLMREQLIAVIGDIRSGAEVINAGTGEIIAGNMELSSHTERQAIALEKT
SASMEEITSTVKQNAENTEQARQLAHSTLEIASRGGAVMQEVNDTMNDISESSDKIANIT
EVVNNIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLALRSAQAAREIKSLIEESV
SRVNSGSTKIKVADSSIKEVVSAVQHVADIMVEISTATSEQGKGISYINESIVQIDSITQ
QNMALVQQAVAAANELELQAQRLKESVAYFNTDGAGHSRDTLTISHTA