Protein Info for DZA65_RS06185 in Dickeya dianthicola ME23

Annotation: Kef family K(+) transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details amino acids 336 to 362 (27 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 16 to 295 (280 residues), 250.7 bits, see alignment E=9.6e-79 PF00999: Na_H_Exchanger" amino acids 17 to 384 (368 residues), 180.4 bits, see alignment E=7.5e-57 PF02254: TrkA_N" amino acids 422 to 535 (114 residues), 88.8 bits, see alignment E=4.9e-29

Best Hits

Swiss-Prot: 77% identical to YBAL_ECOLI: Putative cation/proton antiporter YbaL (ybaL) from Escherichia coli (strain K12)

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 96% identity to ddd:Dda3937_03285)

Predicted SEED Role

"POTASSIUM/PROTON ANTIPORTER ROSB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CMI5 at UniProt or InterPro

Protein Sequence (561 amino acids)

>DZA65_RS06185 Kef family K(+) transporter (Dickeya dianthicola ME23)
MHDNATPLISTMAVGLVLAFLLGILANRLRISPLVGYLVAGVMVGPFTPGFVADTQLAPE
IAELGVILLMFGVGLHFSLGDLMAVKSIAIPGAVAQIMMATLLGAGLSSLLGWSLSEGLV
FGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLAMVLTLVLLPAFADMLKTDA
ANTGKLLQDLAITLGKVVAFITLMVVVGRRVVPWVLAKSASTGSRELFTLSVLAMALGIA
FGAVKLFDVSFALGAFFAGVVLNESELSQRAAHDTLPLRDAFAVLFFVSVGMLFDPMILV
SEPLAVLSTLLIIVIGKSMAAFFLVHMFGHSKRTALTISVSLAQIGEFAFILAGLGISLG
MLSENGRNLVLAGAILSIMINPLLFALLERYLAKHETIEEQIVEEAIEEEKQIPIDLCNH
ALLVGYGRVGSLIGARLYQAGVPMVVIETSRARVDALREQGIKTVLGNATRPDIMDIARL
DCASWLLLTIPNGYEAGEIVAAARARRPDLKIIARAHYDDEVAYITEHGADHVIMGEREI
AETMITMLNVDEMAAAKVCPL