Protein Info for DZA65_RS06100 in Dickeya dianthicola ME23

Annotation: Hha toxicity modulator TomB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 PF10757: YbaJ" amino acids 1 to 118 (118 residues), 201.9 bits, see alignment E=1.7e-64

Best Hits

Swiss-Prot: 62% identical to TOMB_ECOLI: Hha toxicity modulator TomB (tomB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_03303)

Predicted SEED Role

"FIG00948312: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CQB3 at UniProt or InterPro

Protein Sequence (122 amino acids)

>DZA65_RS06100 Hha toxicity modulator TomB (Dickeya dianthicola ME23)
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSRSWVNDPTSAVNLQLNELIEHIAAFVV
TYKIKYPHEAALCERVEKYLDDTYILFSNYGINDAELQKWRKSKSQLFRMFSEKSICTVV
KT