Protein Info for DZA65_RS06075 in Dickeya dianthicola ME23

Annotation: acyl-CoA thioesterase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00189: acyl-CoA thioesterase II
  • amino acids 12 to 283 (272 residues), 342.2 bits, E=1.3e-106
• PF02551: Acyl_CoA_thio
  • amino acids 23 to 103 (81 residues), 36.6 bits, E=6e-13
  • amino acids 149 to 281 (133 residues), 156.2 bits, E=6.1e-50
• PF13622: 4HBT_3
  • amino acids 33 to 109 (77 residues), 68.7 bits, E=6.5e-23
• PF20789: 4HBT_3C
  • amino acids 157 to 282 (126 residues), 85.1 bits, E=8.4e-28

Best Hits

Swiss-Prot: 76% identical to TESB_ECO57: Acyl-CoA thioesterase 2 (tesB) from Escherichia coli O157:H7

KEGG orthology group: K10805, acyl-CoA thioesterase II [EC: 3.1.2.-] (inferred from 97% identity to ddd:Dda3937_03307)

MetaCyc: 76% identical to acyl-CoA thioesterase II (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]; 3.1.2.- [EC: 3.1.2.20]; 3.1.2.- [EC: 3.1.2.20]; 3.1.2.- [EC: 3.1.2.20]

Predicted SEED Role

"Acyl-CoA thioesterase II (EC 3.1.2.-)" (EC 3.1.2.-)

MetaCyc Pathways

• oleate β-oxidation (29/35 steps found)
• oleate β-oxidation (thioesterase-dependent, yeast) (2/2 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• acyl-CoA hydrolysis (1/1 steps found)
• palmitoleate biosynthesis IV (fungi and animals) (1/2 steps found)
• firefly bioluminescence (3/14 steps found)
• jasmonic acid biosynthesis (5/19 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-, 3.1.2.20

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Sequence Analysis Tools

See A0A385XY44 at UniProt or InterPro

Protein Sequence (287 amino acids)

>DZA65_RS06075 acyl-CoA thioesterase II (Dickeya dianthicola ME23)
MSQALQNLLNLLNLEKLEEGLFRGQSQDLGLRQVFGGQVVGQALSAAKQTVPAERSIHSF
HSYFLLPGDSQKPIIYDVETLRDGNSFSARRVSAIQNGRSIFYMTASFQTRESGFEHQSD
MPQVTQPDDLPSEQNIARSMEHLIPPVMRQVFTNDRPIEIRPVKFHNPLKGDAAPPVRQV
WCRANGAMPDDERTHQYLLGYTSDCHFLLTALQPHGVGFLERGMQVATIDHAMWFHRPFR
LDDWLLYSVESPSASGARGFVRGQFYTREGVLVASSVQEGVIRRHGQ