Protein Info for DZA65_RS06045 in Dickeya dianthicola ME23

Annotation: PLP-dependent cysteine synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF00291: PALP" amino acids 23 to 314 (292 residues), 157.2 bits, see alignment E=3.1e-50

Best Hits

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 98% identity to ddd:Dda3937_03313)

Predicted SEED Role

"Cysteine synthase B (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CQX4 at UniProt or InterPro

Protein Sequence (350 amino acids)

>DZA65_RS06045 PLP-dependent cysteine synthase family protein (Dickeya dianthicola ME23)
MTSTWVRDAVSAIEADFQRSADTHLIRLTLPDYPGIYFYLKDESTHPSGSLKHRLARSLF
LYGLCNGWINEGTPIIEASSGSTAVSEAYFARLLGLPFIAVMPACTARRKIEQITFYGGN
CHFVEQSGQIYVASEVLAKELHGHYMDQFTYAERATDWRGNNNIADSIYRQMEREPFPVP
DYLVMSAGTGGTSATLGRYIRYKGLDTQLVVVDPENSVFYDCYRQQDRTLTGKCNSRIEG
IGRPRAEPSFIPGVIDDMMKVPDAASIATLYWLERILGRKVGPSTGTNVWGMLQLAGQMV
EEGRHGAIVTLLCDSGERYLDTYYNQDWVRTQIGDITPYLQQLTEGYRFP