Protein Info for DZA65_RS05975 in Dickeya dianthicola ME23
Annotation: cytochrome o ubiquinol oxidase subunit III
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 80% identical to CYOC_SHIFL: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Shigella flexneri
KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 97% identity to dze:Dd1591_3075)MetaCyc: 80% identical to cytochrome bo3 subunit 3 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]
Predicted SEED Role
"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)
MetaCyc Pathways
- NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
- NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
- glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
- proline to cytochrome bo oxidase electron transfer (1/2 steps found)
- succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
Isozymes
Compare fitness of predicted isozymes for: 1.10.3.-
Use Curated BLAST to search for 1.10.3.- or 7.1.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CF62 at UniProt or InterPro
Protein Sequence (204 amino acids)
>DZA65_RS05975 cytochrome o ubiquinol oxidase subunit III (Dickeya dianthicola ME23) MSTDTLTHHNTAHAEHGHHDTGGNKVFGFWIYLMSDCILFGMLFATYAVLVNGTAGGPTG KELFDLKFVLVETFALLFSSITYGMAMIAMNKGNKSQVNAWLGLTFLFGLVFIGMEIYEF HHLIAEGAGPDRSAFLSAFFALVGTHGIHVTSGLIWIAIMMIQVTKYGLTSTNKTRLMCL SLFWHFLDVVWICVFTVVYLMGAM