Protein Info for DZA65_RS05930 in Dickeya dianthicola ME23

Annotation: tRNA 4-thiouridine(8) synthase ThiI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 TIGR00342: tRNA sulfurtransferase ThiI" amino acids 4 to 375 (372 residues), 453.1 bits, see alignment E=7.6e-140 PF22025: ThiI_fer" amino acids 9 to 76 (68 residues), 37.4 bits, see alignment E=5.5e-13 PF02926: THUMP" amino acids 84 to 161 (78 residues), 56.5 bits, see alignment E=6.1e-19 PF02568: ThiI" amino acids 175 to 368 (194 residues), 263.3 bits, see alignment E=2.6e-82 TIGR04271: thiazole biosynthesis domain" amino acids 382 to 482 (101 residues), 136.4 bits, see alignment E=3.1e-44

Best Hits

Swiss-Prot: 91% identical to THII_PECCP: tRNA sulfurtransferase (thiI) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03151, thiamine biosynthesis protein ThiI (inferred from 98% identity to ddd:Dda3937_01963)

MetaCyc: 85% identical to tRNA uridine 4-sulfurtransferase (Escherichia coli K-12 substr. MG1655)
tRNA sulfurtransferase. [EC: 2.8.1.4]; 2.8.1.- [EC: 2.8.1.4]

Predicted SEED Role

"Thiamine biosynthesis protein thiI"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZD1 at UniProt or InterPro

Protein Sequence (482 amino acids)

>DZA65_RS05930 tRNA 4-thiouridine(8) synthase ThiI (Dickeya dianthicola ME23)
MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKQYDETLAVVRHWDHIDVRAKDESQR
VAIRDALTRIPGIHHILDVEECTYTDVHHIFEQALATYREQLEGKTFCVRVKRRGKHDFS
SQDVERYVGGGLNQHIESARVNLTAPQVTVHLEIEQDRLLLVKGRYEGIGGFPIGTQEDV
LSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQVAHYLWNRFGSSHRVRFV
AIDFEPVVGEILEKVDDGQMGVVLKRMMVRAASRIAERYGVQALVTGEALGQVSSQTLTN
LRLIDNASDTLILRPLISHDKEHIIRMARELGTEDFAKTMPEYCGVISKSPTVKAVKAKI
EHEESLFDFSILEQVVAQARNIDIREIAEQTQQDVAEVETVGAFAASDILLDIRSPDEQD
ERPLALEQVEVKSLPFYKLGTQFGYLDQSKTYLLYCERGVMSRLQALYLREQGFNNVKVY
RP