Protein Info for DZA65_RS05895 in Dickeya dianthicola ME23

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF00885: DMRL_synthase" amino acids 13 to 151 (139 residues), 188.6 bits, see alignment E=2.5e-60 TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase" amino acids 14 to 150 (137 residues), 193 bits, see alignment E=1.2e-61

Best Hits

Swiss-Prot: 87% identical to RISB_PECCP: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 98% identity to dze:Dd1591_3089)

MetaCyc: 83% identical to 6,7-dimethyl-8-ribityllumazine synthase (Escherichia coli K-12 substr. MG1655)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CDU4 at UniProt or InterPro

Protein Sequence (157 amino acids)

>DZA65_RS05895 6,7-dimethyl-8-ribityllumazine synthase (Dickeya dianthicola ME23)
MNIIEGVVAAPNARVAIAIARFNHFINDSLLEGALDALKRIGQVKEENVTVVWVPGAYEL
PLTARALANSQRYDAVVALGTVIRGGTAHFEFVAGECSSGLSHVAMNSDIPVAFGVLTTE
SIEQAIERAGTKAGNKGAEAALTALEMINVLHSIKSA