Protein Info for DZA65_RS05855 in Dickeya dianthicola ME23

Annotation: tRNA guanosine(34) transglycosylase Tgt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR00430: tRNA-guanine transglycosylase" amino acids 3 to 368 (366 residues), 631.9 bits, see alignment E=3.3e-194 TIGR00449: tRNA-guanine family transglycosylase" amino acids 3 to 367 (365 residues), 597.9 bits, see alignment E=6.4e-184 PF01702: TGT" amino acids 11 to 365 (355 residues), 565.4 bits, see alignment E=2.6e-174

Best Hits

Swiss-Prot: 93% identical to TGT_PECCP: Queuine tRNA-ribosyltransferase (tgt) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 98% identity to ddc:Dd586_1003)

MetaCyc: 91% identical to tRNA-guanine transglycosylase (Escherichia coli K-12 substr. MG1655)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWM1 at UniProt or InterPro

Protein Sequence (384 amino acids)

>DZA65_RS05855 tRNA guanosine(34) transglycosylase Tgt (Dickeya dianthicola ME23)
MKYELLQTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKDTGAQIILGNTFH
LWLRPGQEIMKRHGDLHDFMQWHGPILTDSGGFQVFSLGDIRKITEEGVHFRNPINGDAI
FLSPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRQRFDELSNKN
ALFGIVQGSVYEDLRDVSVKGLVDIGFDGYAVGGLAVGEPKADMHRILEHVCPQLPTDKP
RYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNAKHKDDTGPLDE
HCDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRQAIEEGRLEGFAAE
FYQRIGKPVPPLVDNAVGNDCGGK