Protein Info for DZA65_RS05805 in Dickeya dianthicola ME23

Annotation: exonuclease subunit SbcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR00619: exonuclease SbcCD, D subunit" amino acids 1 to 259 (259 residues), 242.6 bits, see alignment E=2.9e-76 PF00149: Metallophos" amino acids 1 to 232 (232 residues), 50.2 bits, see alignment E=7e-17 PF12320: SbcD_C" amino acids 283 to 379 (97 residues), 79 bits, see alignment E=4e-26

Best Hits

KEGG orthology group: K03547, exonuclease SbcD (inferred from 96% identity to ddd:Dda3937_01938)

Predicted SEED Role

"Exonuclease SbcD" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWL1 at UniProt or InterPro

Protein Sequence (410 amino acids)

>DZA65_RS05805 exonuclease subunit SbcD (Dickeya dianthicola ME23)
MRIIHTSDWHLGQYFYTRSRAPEHQAFLHWLVQQVEQHQADAVIVAGDVFDNGAPPSYAR
EMYNQFVVALQRTGCQLVVMGGNHDSVATLNESRALLACLNTRVVAGFDGDIHEQVLVLN
NRAGEPGALLCAVPFLRPRDLLTSQAGQSGVQKQQALQDAITSHYQRCYQLACEQRETLG
RELPIVLTGHLTTVGVATSDSVRDIYIGTLDAFPAQAFPPADYIALGHIHRPQRVAQCEH
IRYSGSPIPLSFDELNHEKSVYLVHFEQGKLQEVAALTVPTEQPMQLVKGNLSEIERRLA
GFRDYHGDKPVWLDIEIATQDYLSDMQQHIQALTEPLNVDVLLLRRAREQQQQMLVQLEK
ETLEELHPAEVFARRLALESDLDEARQPRLKGLFDQVIQEIDEQRREASA