Protein Info for DZA65_RS05785 in Dickeya dianthicola ME23

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 269 to 294 (26 residues), see Phobius details PF02743: dCache_1" amino acids 86 to 255 (170 residues), 72.7 bits, see alignment E=6.8e-24 PF22673: MCP-like_PDC_1" amino acids 110 to 173 (64 residues), 41.3 bits, see alignment E=3.9e-14 PF00672: HAMP" amino acids 290 to 343 (54 residues), 46.7 bits, see alignment 6.6e-16 PF00015: MCPsignal" amino acids 411 to 562 (152 residues), 176.8 bits, see alignment E=7.1e-56

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 94% identity to ddd:Dda3937_01934)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C9Y6 at UniProt or InterPro

Protein Sequence (596 amino acids)

>DZA65_RS05785 methyl-accepting chemotaxis protein (Dickeya dianthicola ME23)
MLKTIRARILAVCTAIIVVALVINTFLNYRVTDKYNDESINNLLTAVTAGHSLAISDWVA
AKKQIITSLNTVVLTNDDPIPVFKQMTTAGSFINVYMGYASHTAKFADPGGIPANYDPTV
RPWYQQAVREGKAIATAPYLDMATNTIVVSFVAPVLDGGSVKGVLGSDVTMDSVIANVKA
IHPTPASYGILIQADGTIIAHPDAKLTLKKLTEIAPQMNLGLVLKSDRPVPLNISGHDML
VRTQPVTGTDWYVLVALDKAEATAGMDSLLWTSVIALVIISVLGSVVLGLLINASLKRLL
QIRDAMDDISHGNNDLTQRLPDEGHDEVSQIARSFNSFVDKLSMIMLQIRDISASLQTAT
DEVATGNNDLASRTESAAASLQQTAAALEQISAAVTQSAGSAQQVNDRALALANDAGTGG
KVVSEVIDTMEAIEVASGKIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
EVRSLAQRSAQAAKEIKTLIESTVLSVNVGSRQVRQAGNTMNEIVGGVSSVTTVMSEITH
ASGEQMRGIQEINKAVAQLDSMVQQNAAMVQEAASAFGSLQSQSEELHSSISHFKL