Protein Info for DZA65_RS05725 in Dickeya dianthicola ME23

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF13302: Acetyltransf_3" amino acids 8 to 141 (134 residues), 36.8 bits, see alignment E=1.6e-12 PF13420: Acetyltransf_4" amino acids 13 to 160 (148 residues), 37.9 bits, see alignment E=4.7e-13 PF13673: Acetyltransf_10" amino acids 30 to 145 (116 residues), 32.4 bits, see alignment E=2.1e-11 PF00583: Acetyltransf_1" amino acids 33 to 140 (108 residues), 59.9 bits, see alignment E=7.4e-20 PF13508: Acetyltransf_7" amino acids 56 to 141 (86 residues), 44 bits, see alignment E=6.1e-15

Best Hits

Swiss-Prot: 53% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 87% identity to ddd:Dda3937_01922)

Predicted SEED Role

"FIG01201438: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUF1 at UniProt or InterPro

Protein Sequence (176 amino acids)

>DZA65_RS05725 N-acetyltransferase (Dickeya dianthicola ME23)
MSIILIEDAQAEHIAAIRDIYAQHVLHSLATFETEPPDEAEMRQRWQKIHDAGLPWLVAI
ENQQVLGYCYLGGYRTRVAYRFTLEDSIYLHPDHLGKGIGKRLLSAALSRAEQQGYRQVI
SVVGNSANQASLQLHLSLGFERVGTLRSVGMKHGRWVDTVLLQRALGEGDAALPPA