Protein Info for DZA65_RS05660 in Dickeya dianthicola ME23

Annotation: molybdopterin-synthase adenylyltransferase MoeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00581: Rhodanese
  • amino acids 18 to 104 (87 residues), 63.3 bits, E=2.6e-21
• PF00899: ThiF
  • amino acids 123 to 357 (235 residues), 225.7 bits, E=4e-71

Best Hits

KEGG orthology group: None (inferred from 92% identity to ddc:Dd586_0966)

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)

Sequence Analysis Tools

See A0A385XXW2 at UniProt or InterPro

Protein Sequence (361 amino acids)

>DZA65_RS05660 molybdopterin-synthase adenylyltransferase MoeB (Dickeya dianthicola ME23)
MSNIVDGIDSIHSISIDELKDSDDFLLIDVRESHEYLDGTIPKALTIGRGFLEIELKKRK
IELDRPIVLFCASGLRSRYAALNLMLLNYSNIYSLQGGFEAWKAQGNQIEYPLLLSENDK
KRYARHLSLQDIGSDGQLKIMQAKVLVVGAGGLGSSCLLYLAAAGVGEIAIVDHDVVDLS
NLQRQVIHNEKMLKKKKVDSALHTLRALNSEITINTIDERVTPENIDALIDGYDVIVDCT
DNFNARYIINDSAVAAGKPVVSAAVFRFSGQVMTRSTNQAPCYRCIYPEAPPAELAPSCT
ENGVIGVIPGMLGIYQANEVLKIILGIGDCLNGKLLKIDMLSNQHQLLTTKKRPGCQCHN
N