Protein Info for DZA65_RS05610 in Dickeya dianthicola ME23

Annotation: YbhB/YbcL family Raf kinase inhibitor-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00481: Raf kinase inhibitor-like protein, YbhB/YbcL family" amino acids 48 to 187 (140 residues), 129.3 bits, see alignment E=4.8e-42 PF01161: PBP" amino acids 51 to 187 (137 residues), 140.7 bits, see alignment E=2e-45

Best Hits

Swiss-Prot: 54% identical to YBCL_ECOLI: UPF0098 protein YbcL (ybcL) from Escherichia coli (strain K12)

KEGG orthology group: K06910, (no description) (inferred from 88% identity to dze:Dd1591_3134)

Predicted SEED Role

"UPF0098 protein ybcL precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CFA2 at UniProt or InterPro

Protein Sequence (192 amino acids)

>DZA65_RS05610 YbhB/YbcL family Raf kinase inhibitor-like protein (Dickeya dianthicola ME23)
MKTRSRLIRTCAPLLAGLFMTAAAHAEPLTLSSPTIAPNSTLPVSFEFNGFGCNGQNQSP
ALNWRGAPAGTQSFAVTVYDPDAPTGSGWWHWMVINIPANVTEFVANAGEIGGKHLPAGA
RQVRIDYGVDAWGGVCPPAGDKPHRYIFTVYALKTKALDVPKDANPALGGYMINANTLAK
ASFTAYYGRPAQ