Protein Info for DZA65_RS05595 in Dickeya dianthicola ME23

Annotation: 3-oxoacyl-ACP reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 195 (189 residues), 182.3 bits, E=1.6e-57
• PF01370: Epimerase
  • amino acids 9 to 187 (179 residues), 24.4 bits, E=3.6e-09
• PF08659: KR
  • amino acids 10 to 181 (172 residues), 35.4 bits, E=2.1e-12
• PF13561: adh_short_C2
  • amino acids 13 to 245 (233 residues), 201.4 bits, E=3.5e-63

Best Hits

KEGG orthology group: None (inferred from 96% identity to dze:Dd1591_3138)

MetaCyc: 36% identical to 4-sulfobenzyl alcohol dehydrogenase subunit (Comamonas testosteroni T-2)
1.1.1.M5 [EC: 1.1.1.M5]; 4-(hydroxymethyl)benzenesulfonate dehydrogenase. [EC: 1.1.1.M5, 1.1.1.257]

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

• palmitate biosynthesis III (28/29 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (16/16 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• 4-toluenecarboxylate degradation (1/3 steps found)
• 4-toluenesulfonate degradation I (1/4 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.257 or 1.1.1.M5 or 1.3.1.10

Sequence Analysis Tools

See A0A385XUH6 at UniProt or InterPro

Protein Sequence (246 amino acids)

>DZA65_RS05595 3-oxoacyl-ACP reductase FabG (Dickeya dianthicola ME23)
MTELIGKKALVTGASRGIGAAIALELAEKGADVAITYQNSDARALEVVQAIEAKGRRAFA
IKANSADAQAVTHSVHEAADKLGGLDILVNNAGIARAGMVADMSLAYINDILDVNVRAVV
LASQAAITHLSEGGRIISIGSGVAERVPYPGMAVYAMSKSALLSFTRGLARELGPRGITV
NLVHPGSTDTDMNPADGSHADAQRVLIALGEYGKPEDIAAAVAFLASPAARHITGTGITV
DGGANA