Protein Info for DZA65_RS05590 in Dickeya dianthicola ME23

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF22381: Staph_reg_Sar_Rot" amino acids 29 to 110 (82 residues), 56 bits, see alignment E=8.7e-19 PF12802: MarR_2" amino acids 35 to 94 (60 residues), 38.1 bits, see alignment E=3.6e-13 PF01047: MarR" amino acids 37 to 95 (59 residues), 50 bits, see alignment E=5.4e-17 PF13463: HTH_27" amino acids 38 to 103 (66 residues), 24.2 bits, see alignment E=8.2e-09 PF01638: HxlR" amino acids 42 to 113 (72 residues), 21.9 bits, see alignment E=3.3e-08

Best Hits

Swiss-Prot: 38% identical to OHRR_BACSU: Organic hydroperoxide resistance transcriptional regulator (ohrR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_01902)

Predicted SEED Role

"Organic hydroperoxide resistance transcriptional regulator" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CE68 at UniProt or InterPro

Protein Sequence (144 amino acids)

>DZA65_RS05590 MarR family transcriptional regulator (Dickeya dianthicola ME23)
MNNKQRREIGTELSFALYGAANRMNRMHKIFLDPLGLTFPQYLVMLELFNQTPRTVGELG
NKLGMDTGTITPLLKRLETAGRVQRTRDTNDERRVLITLTEAGEALHDELWSITGKIKSA
CRLTEDELTQLRDTLNAFAHPASE