Protein Info for DZA65_RS05565 in Dickeya dianthicola ME23

Annotation: copper homeostasis protein CutF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04170: NlpE" amino acids 38 to 121 (84 residues), 68.4 bits, see alignment E=3.8e-23

Best Hits

KEGG orthology group: K06079, copper homeostasis protein (lipoprotein) (inferred from 86% identity to ddd:Dda3937_01898)

Predicted SEED Role

"Copper homeostasis protein CutF precursor / Lipoprotein NlpE involeved in surface adhesion" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUB9 at UniProt or InterPro

Protein Sequence (202 amino acids)

>DZA65_RS05565 copper homeostasis protein CutF (Dickeya dianthicola ME23)
MKKLAIGVVLVVLLSGLMGCHSRPQIQEESLRPMAQYYRGKLPCGACGEMDTTLFLNTDG
SFVMQESYPSGADGNTTVAESGRWSRTAERLVLTDDYGEKRYFRPLNNDLEALSDDGQPL
DAATQRHRLLAVDKQDKPVAPACLSQLSGRDMRAVTAAIERYMARQPDGHVFSVAMEPES
AAVRVSYYSYSRAIDYPIPVTL