Protein Info for DZA65_RS05515 in Dickeya dianthicola ME23

Annotation: acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase" amino acids 8 to 260 (253 residues), 353.4 bits, see alignment E=3.1e-110 PF00132: Hexapep" amino acids 17 to 52 (36 residues), 34.2 bits, see alignment 2e-12 amino acids 109 to 143 (35 residues), 40.9 bits, see alignment 1.7e-14 PF13720: Acetyltransf_11" amino acids 180 to 261 (82 residues), 98.6 bits, see alignment E=3.3e-32

Best Hits

Swiss-Prot: 90% identical to LPXA_PECAS: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 97% identity to ddc:Dd586_0941)

MetaCyc: 82% identical to acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Escherichia coli K-12 substr. MG1655)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D386 at UniProt or InterPro

Protein Sequence (262 amino acids)

>DZA65_RS05515 acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Dickeya dianthicola ME23)
MIDQTAFIHPSSIVEDGAVIGAGAHIGPFCHIGAQVEIGAGTVLKSHVVVNGITKIGRDN
EIYQFVTIGEVNQDLKYAGEPTRVEVGDRNRIRESVTIHRGTAQGGGLTKVGNDNLLMIN
THIAHDCTIGNHCILANNATLGGHVSIDDFAIIGGMTAVHQFCVIGAHVMVGGCSGVAQD
VPPYLIAQGNHATPFGINIEGLKRRGFEKETLHAIRNAYKLIYRSGRTLDEVKADLEALA
AEHPAVQAYLDFFTRSTRGIIR