Protein Info for DZA65_RS05300 in Dickeya dianthicola ME23

Annotation: phosphoenolpyruvate--protein phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 transmembrane" amino acids 142 to 159 (18 residues), see Phobius details PF13185: GAF_2" amino acids 16 to 154 (139 residues), 58.3 bits, see alignment E=3.1e-19 PF01590: GAF" amino acids 18 to 153 (136 residues), 68.9 bits, see alignment E=2e-22 PF13492: GAF_3" amino acids 20 to 151 (132 residues), 34.5 bits, see alignment E=7.6e-12 PF05524: PEP-utilisers_N" amino acids 173 to 294 (122 residues), 80.2 bits, see alignment E=4.3e-26 TIGR01417: phosphoenolpyruvate-protein phosphotransferase" amino acids 176 to 730 (555 residues), 407.5 bits, see alignment E=4.2e-126 PF00391: PEP-utilizers" amino acids 320 to 391 (72 residues), 51.9 bits, see alignment E=1.5e-17 PF02896: PEP-utilizers_C" amino acids 420 to 706 (287 residues), 350.4 bits, see alignment E=2.3e-108

Best Hits

Swiss-Prot: 72% identical to PT1P_SALTY: Phosphoenolpyruvate-dependent phosphotransferase system (ptsP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08484, phosphotransferase system, enzyme I, PtsP [EC: 2.7.3.9] (inferred from 98% identity to ddd:Dda3937_00849)

MetaCyc: 72% identical to phosphoenolpyruvate-protein phosphotransferase PtsP (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphoenolpyruvate-protein phosphotransferase, nitrogen regulation associated"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.9

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZ22 at UniProt or InterPro

Protein Sequence (748 amino acids)

>DZA65_RS05300 phosphoenolpyruvate--protein phosphotransferase (Dickeya dianthicola ME23)
MLMRLREIIEKVAAAARLNDALDILVNETCLAIDTEVCSIYLADHDRQCYYLMATRGLKK
PRGRTITLAFGQGIVGLVGERAEPINLADAQSHPSFKFIPAVREQHFRSFLGVPVIHRRQ
LLGVLVVQQREHRQFDKNEESFMVTLATQMAAILSLSQMKALFGQYRQTRIKAMAASSGV
AIAPGWQDRGQPSLELVFPASSLDSDRERSRLLIAMEEAGAEFRRFSKRFSASAQKESAA
IFDFYSHLLNDARLKRELLQEVDTGSVAEWAVKVVTERFAAQFASLQDPYLRDRSSDLRA
LGQRLLFHLDDNAQSNGQWPERFILVTDELTATLLAEVPQERLAGVVAYDGAANSHAAIL
VRAMGIPTLMGADIQPELLHQRLLVLDGYRGELLVDPEPVLVQEYQRLLSEENELTRLAE
DDMERPAVLKSGERVDVMLNAGLSAEHEKRFINQVDGVGLYRTEIPFMLQNGFPSEEEQM
TQYEGMLRLYPTRPVMLRTLDIGADKQLPYLPISEENPCLGWRGIRVTLDQPEIFMIQVR
AMLRANAHIGNLSILLPMINSLDEIDEAKRLIDRAAAEVSEMFGFPQPQPRIGIMIEVPS
VLFLLPHLASRIDFVSVGTNDLTQYLLAVDRNNPHVGALYDSLHPSMLQALNMIITHCRQ
YSLPVSVCGEMAGEPMGALLLIGLGYRTLSMNGRSVARIKYLLRRIGEEESRQLVDKVLR
AQTASEVRQWASIFIEERGLGGLIRGGR