Protein Info for DZA65_RS05250 in Dickeya dianthicola ME23

Annotation: tRNA (guanosine(46)-N7)-methyltransferase TrmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR00091: tRNA (guanine-N(7)-)-methyltransferase" amino acids 49 to 237 (189 residues), 232 bits, see alignment E=1.9e-73 PF02390: Methyltransf_4" amino acids 64 to 233 (170 residues), 208.4 bits, see alignment E=5.7e-66 PF01596: Methyltransf_3" amino acids 64 to 144 (81 residues), 22.4 bits, see alignment E=7e-09

Best Hits

Swiss-Prot: 84% identical to TRMB_PECAS: tRNA (guanine-N(7)-)-methyltransferase (trmB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03439, tRNA (guanine-N7-)-methyltransferase [EC: 2.1.1.33] (inferred from 97% identity to ddc:Dd586_0888)

MetaCyc: 81% identical to tRNA m7G46 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (guanine-N(7)-)-methyltransferase. [EC: 2.1.1.33]

Predicted SEED Role

"tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)" (EC 2.1.1.33)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D3C8 at UniProt or InterPro

Protein Sequence (239 amino acids)

>DZA65_RS05250 tRNA (guanosine(46)-N7)-methyltransferase TrmB (Dickeya dianthicola ME23)
MINNVISPEFDENGRPLRRIRSFVRRQGRLTKGQQQALDDFWPVMGVEYQNEALDFARLF
GRAAPVVLEIGFGMGASLVTMAQQHPEQNFIGIEVHVPGVGACLGAAQEAGVDNLRVMCH
DAVEVLERMIPDGSLAMVQLFFPDPWHKARHNKRRIVQAPFAELVRSKLAVGGVFHMATD
WEPYAQHMLEVMSSLAGYRNLSDHNDYVPRPASRPLTKFEARGQRLGHGVWDLMFERNQ