Protein Info for DZA65_RS05030 in Dickeya dianthicola ME23

Annotation: TIGR03749 family integrating conjugative element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03749: integrating conjugative element protein, PFL_4704 family" amino acids 13 to 287 (275 residues), 332.4 bits, see alignment E=1e-103 PF11920: DUF3438" amino acids 22 to 295 (274 residues), 323.1 bits, see alignment E=6e-101

Best Hits

KEGG orthology group: None (inferred from 63% identity to pwa:Pecwa_0657)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CT24 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DZA65_RS05030 TIGR03749 family integrating conjugative element protein (Dickeya dianthicola ME23)
MTVFSRITSALLIAAAFPVSAVELMRWERIPLQVPLNVGQERIVFVDKNVRVGFPPSLKD
KLRVQSSGGAVYLSASEAFPTTRLTLLDAESGEIILLDISASAGKALREPVKVVYEGEVT
SVSSPDNAKTTGSSNGNGHRASSGSVKSESADSGSGSTSRRQAPSLNAPLPVVMTRYAAQ
NLYAPLRAVESVPGIHPVPLRLPGTITTLYPSEPVQIKPLAAWALNEHTVVALQVRNTST
RKVILDPRRLDGRFLSAAFQHRWLGRAGTPEDTTAVYLVVQGKPDSAFIAEPVMPAQSTK
KR