Protein Info for DZA65_RS05015 in Dickeya dianthicola ME23

Annotation: TIGR03745 family integrating conjugative element membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 53 to 75 (23 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details TIGR03745: integrating conjugative element membrane protein, PFL_4702 family" amino acids 12 to 112 (101 residues), 123.4 bits, see alignment E=1.6e-40 PF11190: DUF2976" amino acids 25 to 111 (87 residues), 104 bits, see alignment E=1.7e-34

Best Hits

KEGG orthology group: None (inferred from 73% identity to yen:YE3488)

Predicted SEED Role

"probable membrane protein STY4566"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CYV5 at UniProt or InterPro

Protein Sequence (112 amino acids)

>DZA65_RS05015 TIGR03745 family integrating conjugative element membrane protein (Dickeya dianthicola ME23)
MKNLLNFFGKTFLFAVLSFSAYADLPPVEASSSGGGGGIFNSMKGYIRDGASLGGLVIAV
IAFIVVANAAISCFHHVRQGKATWTEFGAFIIVGVVLLVAVIWLLTKSADIL