Protein Info for DZA65_RS04960 in Dickeya dianthicola ME23

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 223 to 242 (20 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details PF13476: AAA_23" amino acids 6 to 50 (45 residues), 33.7 bits, see alignment 1.2e-11 PF13304: AAA_21" amino acids 170 to 282 (113 residues), 47.9 bits, see alignment E=3.8e-16

Best Hits

KEGG orthology group: None (inferred from 56% identity to hap:HAPS_1416)

Predicted SEED Role

"putative ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CQA4 at UniProt or InterPro

Protein Sequence (342 amino acids)

>DZA65_RS04960 AAA family ATPase (Dickeya dianthicola ME23)
MLKLAKLKNFTTLPNETIVFAPGLNVIVAENGCGKTHLLKAIYSLLSVNTGKDLSKTVLQ
KSYADKLMGVFRPESLGRLVKRKQGRERCEIQLQMADSQQNCDINFASNAATAVQVELAP
QVNLSQPPVYLPTRELVTLCPWFINLYDNYHLEFEETWRDTCSLLGAPSVRGPRERLVAE
LMQPLEEAMNGKVFVEANTGRFYLQQSGQKLEMPLVAEGLRKLAMLTRLISTGVLLEQGY
LFWDEPESNLNPKLIKMLAKVILSLAKQGIQIFIASHSLFLLREIEVLARGDYASVARRY
FGLSQGEEGTVLEQADELEDIQTLVLLDEELEQSDRYLGFGE