Protein Info for DZA65_RS04735 in Dickeya dianthicola ME23

Annotation: M48 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF01863: YgjP-like" amino acids 25 to 227 (203 residues), 208.3 bits, see alignment E=1.4e-65 PF10263: SprT-like" amino acids 155 to 214 (60 residues), 26.3 bits, see alignment E=5.6e-10

Best Hits

KEGG orthology group: K07043, (no description) (inferred from 94% identity to kpe:KPK_4971)

Predicted SEED Role

"Putative predicted metal-dependent hydrolase" in subsystem Restriction-Modification System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYR0 at UniProt or InterPro

Protein Sequence (238 amino acids)

>DZA65_RS04735 M48 family metallopeptidase (Dickeya dianthicola ME23)
MPIMQIGTLRLQVNRKAIKNLHISVLPPDGKVRVSAPEHMTETAIRMAVASRFRWIRKQQ
QDFARQPRQSEREMVSGECHYLWGRKYRLFVIERQGRHEVKIAGNNKLQIYVQPGTSNEN
KELVLTDFYRHELKRQVAKLLPEWQDRTGVSPTFWGIKKMKTFWGTCNTTTKRVWLNMEL
VKKPPECLEYILVHELVHLLERHHNERFRLHMDRFIPNWRERRDLLNIMPLAFEAWEY