Protein Info for DZA65_RS04695 in Dickeya dianthicola ME23

Annotation: IS110 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF01548: DEDD_Tnp_IS110" amino acids 7 to 146 (140 residues), 75.2 bits, see alignment E=5.3e-25 PF02371: Transposase_20" amino acids 209 to 286 (78 residues), 72.9 bits, see alignment E=2.3e-24

Best Hits

Swiss-Prot: 78% identical to TRA8_YEREN: Transposase for insertion sequence element IS1328 from Yersinia enterocolitica

KEGG orthology group: None (inferred from 79% identity to rah:Rahaq_1402)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XU05 at UniProt or InterPro

Protein Sequence (334 amino acids)

>DZA65_RS04695 IS110 family transposase (Dickeya dianthicola ME23)
MQTATLIGIDLGKYSFHVHCQDRQGNALLRKKFSRSQLATFLATYPACTVIMESCAGAHY
MARTVSQLGHRVKLIAPQFVRPFVKSNKNDFVDAEAICEAASRPSMRFVTPRTEDQQAMS
ALHRVRSSLIRERVKTTNQIHAFLLEFGISLPRGSAVIKRLPSVLEENGIPPDLERLLAR
LHTHYGYLSEQIKEIDNELKTHLNEDETAQRLLTIPGVGPVTASLLATRLGDGKNYASSR
DFAASTGLVPRQDSTGGKPTLMGISKRGNKVLRSLLVQCARAFMRRLEHNSGRLAEWVKK
QLASHHSNVVACALANKLARIAWAVTAHQTEFSK