Protein Info for DZA65_RS04690 in Dickeya dianthicola ME23

Annotation: NADP-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 250 to 265 (16 residues), see Phobius details PF08240: ADH_N" amino acids 31 to 115 (85 residues), 51.9 bits, see alignment E=1.2e-17 PF00107: ADH_zinc_N" amino acids 161 to 239 (79 residues), 47.5 bits, see alignment E=2.7e-16 PF13602: ADH_zinc_N_2" amino acids 192 to 335 (144 residues), 102 bits, see alignment E=7.7e-33

Best Hits

KEGG orthology group: None (inferred from 85% identity to ent:Ent638_2281)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTU1 at UniProt or InterPro

Protein Sequence (339 amino acids)

>DZA65_RS04690 NADP-dependent oxidoreductase (Dickeya dianthicola ME23)
MKTKTMKAFTFKRYGKSPELGFDDLDYPSPGADEILVKVYAVGLNPIDNMIPTGMFKPVL
HFKLPATLGSDLAGVVVAVGTRVTRFIPGDEIFASIFDREIGSLAEFAVVPESLAAIKPA
NLDFVQAASLPMVSLTSWQALTERANLLPGQKVFIPAGSGGIGSFAIQLAKYLGAKVGTT
TSSVNVEWVNRLGADEVVDYKKQEFENVLSGYDIVLGTVRGDAIEKSTQILKPGGKIISL
IGPLDAAFAQARGLNFLLRFVFGLMSRKIIRLTKKRGLAYSFLFVRPDGAQLTQISKLIE
AEHIIPVIDKVFPFEATKDALDYLAGGHAKGKVVVKIQE