Protein Info for DZA65_RS04615 in Dickeya dianthicola ME23
Annotation: alpha/beta hydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 91% identity to ddd:Dda3937_04484)Predicted SEED Role
"2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation or carbazol degradation cluster (EC 3.7.1.-)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- Ascorbate and aldarate metabolism
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biphenyl degradation
- Caprolactam degradation
- Ethylbenzene degradation
- Inositol phosphate metabolism
- Limonene and pinene degradation
- Nicotinate and nicotinamide metabolism
- Phenylalanine metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.7.1.-
Use Curated BLAST to search for 3.7.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385XYP2 at UniProt or InterPro
Protein Sequence (246 amino acids)
>DZA65_RS04615 alpha/beta hydrolase (Dickeya dianthicola ME23) MLYTKTGSGYPIIFLPGLFAGGWIWNAVVEDIVKKGYSAIVFNESIPVSFGGSYKKAKDA LDSVMEMCHKPPYLVGNSLGALIALHYTSMNLPQVKGLIMSGAPGQIEADAGVSLSELRT GEKKYARQLMGNVYFDKSKVSQRGIDEISHLFSDNQIHKDIVRWLSFSRKYDVPTALNKI TIPTHFIWGDNDMITPIEPWVALSQRKENVTLTAIEDCGHSPMLEKPHAFLDNLLSLLTP EVISER