Protein Info for DZA65_RS04615 in Dickeya dianthicola ME23

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 75 to 87 (13 residues), see Phobius details PF12697: Abhydrolase_6" amino acids 12 to 232 (221 residues), 50.7 bits, see alignment E=5.7e-17 PF12146: Hydrolase_4" amino acids 69 to 226 (158 residues), 42.6 bits, see alignment E=7e-15 PF00561: Abhydrolase_1" amino acids 70 to 227 (158 residues), 38.8 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: None (inferred from 91% identity to ddd:Dda3937_04484)

Predicted SEED Role

"2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation or carbazol degradation cluster (EC 3.7.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYP2 at UniProt or InterPro

Protein Sequence (246 amino acids)

>DZA65_RS04615 alpha/beta hydrolase (Dickeya dianthicola ME23)
MLYTKTGSGYPIIFLPGLFAGGWIWNAVVEDIVKKGYSAIVFNESIPVSFGGSYKKAKDA
LDSVMEMCHKPPYLVGNSLGALIALHYTSMNLPQVKGLIMSGAPGQIEADAGVSLSELRT
GEKKYARQLMGNVYFDKSKVSQRGIDEISHLFSDNQIHKDIVRWLSFSRKYDVPTALNKI
TIPTHFIWGDNDMITPIEPWVALSQRKENVTLTAIEDCGHSPMLEKPHAFLDNLLSLLTP
EVISER