Protein Info for DZA65_RS04545 in Dickeya dianthicola ME23

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF13443: HTH_26" amino acids 15 to 74 (60 residues), 37.7 bits, see alignment E=2e-13 PF01381: HTH_3" amino acids 26 to 71 (46 residues), 23.5 bits, see alignment 4.5e-09

Best Hits

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_01464)

Predicted SEED Role

"hypothetical protein; Some similarities with bacteriophage protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CVW0 at UniProt or InterPro

Protein Sequence (204 amino acids)

>DZA65_RS04545 helix-turn-helix transcriptional regulator (Dickeya dianthicola ME23)
MKTTNAQRKTNIIKNIEYLMRTRGETKASFSNRTGVTRTTIYKILEGRVNKVQQSTINRI
SDFFGVSCEEIEDYDLEKVERLNNTVSFDGNKNPAAIPIIPQSQLLLTRQHKIGQLAVQY
PLTYFFGEEANMVAMQIESPIGNAFSPGALLIIRRPPALMPDTPILCHSPATGFFVDVPD
SSSMTDRKRPEDAVLLGYIIEERI