Protein Info for DZA65_RS04510 in Dickeya dianthicola ME23

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details PF13531: SBP_bac_11" amino acids 63 to 352 (290 residues), 40.8 bits, see alignment E=3.4e-14 PF01547: SBP_bac_1" amino acids 64 to 350 (287 residues), 145 bits, see alignment E=7.7e-46 PF13416: SBP_bac_8" amino acids 70 to 372 (303 residues), 109.5 bits, see alignment E=4e-35

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 92% identity to ddd:Dda3937_01457)

Predicted SEED Role

"Various polyols ABC transporter, periplasmic substrate-binding protein" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTR2 at UniProt or InterPro

Protein Sequence (434 amino acids)

>DZA65_RS04510 ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MFGKRNVFGKRNVFDKSSNTILTTTPHSTKTLSRLLLAAGLACSMASQAADLVIAGRDDV
YGKALDSTLARFQQQHPGKQIELLKLPYANLYEKLVISLRENASAYDLMLMDDSWSPEFA
GNGWLQPLPESLQSSDFIPAVLNVSRVPENGGPVYSLPVVGNVAMFAYRQDLFDKHQLNA
PASWDAVLNDAKTLQQQEPGVSGVVFRGMKGNPIVSGFMPMLWAYGGNVITDGKASLDSP
QALQALNTLKALKAFAPTGVEVYNAADVRQAMEQGKAAMAIEVWPAWAATLDDAAKSNVV
GKMTLQPAPGQNAGPSPMLGIWQMAVAKNSRHNELAQQFLSYLTSAENQKALALELGLPP
TRRSVYQDAQVVQKYRWYPAQLAALEAGKARPRVRNWQEVESILGDYLQLALMDQMPAQV
ALQQANQKIAQVLK