Protein Info for DZA65_RS04505 in Dickeya dianthicola ME23

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 71 to 92 (22 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 152 to 178 (27 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 255 to 281 (27 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 281 (200 residues), 74.4 bits, see alignment E=5.2e-25

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 98% identity to dze:Dd1591_3241)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYM1 at UniProt or InterPro

Protein Sequence (290 amino acids)

>DZA65_RS04505 sugar ABC transporter permease (Dickeya dianthicola ME23)
MHFDSRWQRWLLLLPAATLLLLLTLYPIGQMLLYSFSKVDYAAASRSWVGLENYRQLFAD
WFFTTSLKNTLLFSFGSSLSQVLLGLALALLLHRHFPGRQWVLSLLIYPVMISTLVCSAI
WRVWFHYDFGLLNNCLTALGLMPQPWLSSPYLALWSLMLVDIWQWTPMACLVILAGLQAI
PKDVLEAAESDGANGWKRLWYVTLPLVRQPIMLALLLRSIDTFKLFDKVYALTGGGPGYA
TETLSLYIYQQGFKFFNLGLASAGAVIMLLFAAAMSLVYAWQLLRGGKTA