Protein Info for DZA65_RS04485 in Dickeya dianthicola ME23

Annotation: substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00356: LacI" amino acids 10 to 52 (43 residues), 51.1 bits, see alignment 1.8e-17 PF00532: Peripla_BP_1" amino acids 69 to 265 (197 residues), 62.5 bits, see alignment E=9.4e-21 PF13407: Peripla_BP_4" amino acids 70 to 281 (212 residues), 42.2 bits, see alignment E=1.5e-14 PF13377: Peripla_BP_3" amino acids 174 to 328 (155 residues), 75.2 bits, see alignment E=1.3e-24

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_01452)

Predicted SEED Role

"putative transcriptional regulator protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTS6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>DZA65_RS04485 substrate-binding domain-containing protein (Dickeya dianthicola ME23)
MNKKRITSIDVARCAGVSASAVSRTYSAPGKVSQATRSRVLAAADALGYRPNALARALVN
SGRHGSGIVAVVMGEFDNPFQPWLFSLLTQALQQHGLVPMLVSITEQCDIRARLQQAQSW
QVEAAIISAGSLSREATERCLELSLPMVLMGREDQRETVTAVLSDNRLAGELAADHLISL
GLTRLAYIGGRQDGQASLERLAGFRQRLAHLGLPEPVVTDNPDYAYHSGYHAMCRLRQQH
PMVEGVFCACDALAFGALDALRLTGGPACKVVGCDDTPQAAWEGYRLTTVRQPVELLVEQ
VMRHLQRVLGGESQQGETVRITPTLTVR