Protein Info for DZA65_RS04415 in Dickeya dianthicola ME23

Annotation: nitric oxide reductase transcriptional regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 PF13185: GAF_2" amino acids 20 to 155 (136 residues), 29.3 bits, see alignment E=3.7e-10 PF01590: GAF" amino acids 23 to 154 (132 residues), 47.6 bits, see alignment E=9.9e-16 PF14532: Sigma54_activ_2" amino acids 189 to 359 (171 residues), 73.7 bits, see alignment E=7.5e-24 PF00158: Sigma54_activat" amino acids 189 to 354 (166 residues), 231.1 bits, see alignment E=2.6e-72 PF07728: AAA_5" amino acids 211 to 331 (121 residues), 24.1 bits, see alignment E=1.2e-08 PF00004: AAA" amino acids 212 to 351 (140 residues), 23.7 bits, see alignment E=2.4e-08 PF25601: AAA_lid_14" amino acids 360 to 421 (62 residues), 61.7 bits, see alignment E=2e-20

Best Hits

Swiss-Prot: 82% identical to NORR_PECAS: Anaerobic nitric oxide reductase transcription regulator NorR (norR) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 96% identity to ddd:Dda3937_01437)

Predicted SEED Role

"Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUH8 at UniProt or InterPro

Protein Sequence (508 amino acids)

>DZA65_RS04415 nitric oxide reductase transcriptional regulator NorR (Dickeya dianthicola ME23)
MPLSIDSFAHIAIELQQGLSTRDRFQRLLNSLRQLLCCDAAALLCYESQLLRPLATDGLA
PDVLGRRFRLSEHPRLEAIARAGDVVRFPADSQLPDPYDGLIPGQEALKVHACVGLPLFA
HHTLIGVLTIDGMDPHQFDHFSDEELRLIGAMASVALSNALLMEQLERQALAPLPDAAPM
AEVDADEMVGLSAPMQQLKKEVAIVADSDLNVLIMGETGVGKELVARAIHQGSRRADRPL
VYLNCAALPESVAESELFGHVKGAFTGAIHHRTGKFELADNGTLFLDEIGELSLTLQAKL
LRVLQYGDLQRVGDDSSLKVDVRVLAATNRDLKQSVQEGAFRADLFHRLSVFPLSVPPLR
ARGQDIALLAGFFCERSRARLGLQRLALSPQATQLLAHYPWPGNVRELEHVIYRATIVAR
AGGATGDLTLRPEHLNLDGVLPDELRPADVDTVPAWRGISLRDATEHYQRQVISDTLARH
QGNWSSCARELAVDSGNLHRMAKRLGIK