Protein Info for DZA65_RS04385 in Dickeya dianthicola ME23

Annotation: L-methionine/branched-chain amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 116 to 140 (25 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 223 to 249 (27 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 374 to 407 (34 residues), see Phobius details PF13520: AA_permease_2" amino acids 11 to 379 (369 residues), 98.7 bits, see alignment E=3.8e-32 PF00324: AA_permease" amino acids 24 to 361 (338 residues), 46.4 bits, see alignment E=2.5e-16

Best Hits

Swiss-Prot: 67% identical to YJEH_ECOLI: L-methionine/branched-chain amino acid exporter YjeH (yjeH) from Escherichia coli (strain K12)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 96% identity to ddd:Dda3937_01431)

MetaCyc: 67% identical to L-methionine/branched chain amino acid exporter (Escherichia coli K-12 substr. MG1655)
RXN0-7050; TRANS-RXN-281; TRANS-RXN-282; TRANS-RXN0-270

Predicted SEED Role

"Putative permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D2U9 at UniProt or InterPro

Protein Sequence (417 amino acids)

>DZA65_RS04385 L-methionine/branched-chain amino acid transporter (Dickeya dianthicola ME23)
MGGSNTLKQELGLVQGIGLLSTSLLGTGVFAVPALVAEQARGDSLWAWPLLIALVFPIAI
AFASLGRHFPNAGGAAYFVRLAFGPRLARVTGWLFLSVIPVGLPAAMQIAAGFWQAAFGL
SAGGLLLVQLLTLAVIWLLGMRGAGSSATIQTLIALLVVLLVAAIWWQGRITPSQIPWPA
LADINGAKMLDALAVMFWCFVGLEAFAHLATEFKSPERDFPRALLIGMLLAGAVYWGCTV
AVLLFGAYGPHQAATASLPGIVVRLFGDHALWLACIVGYLACFAGVNIYTQGFARLVWSQ
APEESRLARLSASRTPVNALSLVVACCLICCLIIYWLNLPLSELIVYANGIFILIYLLCM
LAGWRLLRGRSRVMAAIGSVLCAALLLTLGGKSWYALGMLAALWLLLPARREAVTAN