Protein Info for DZA65_RS04335 in Dickeya dianthicola ME23

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details PF00672: HAMP" amino acids 195 to 247 (53 residues), 44.7 bits, see alignment 2.1e-15 PF00512: HisKA" amino acids 253 to 315 (63 residues), 54.8 bits, see alignment E=1.2e-18 PF02518: HATPase_c" amino acids 364 to 470 (107 residues), 81.7 bits, see alignment E=7.9e-27

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 89% identity to ddd:Dda3937_01422)

Predicted SEED Role

"Putative two-component system sensor kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XX64 at UniProt or InterPro

Protein Sequence (472 amino acids)

>DZA65_RS04335 HAMP domain-containing protein (Dickeya dianthicola ME23)
MHGRLFWKILLGLWLTFFVISQLLWVGFSFYGGRNEPPEVRLGKHTMSLQMALAVQALRQ
GGMVELGRTLADWPKSERGYINVSIIGDNDDVAGFGGEPPPEMGMLGEPPRPPEPGFGPG
PIPGPGGRLEQPDAASLQVVDGPDGQRYRVSFNTARWRQDLMPENGPAPIPFFLHLPPPM
IWLGALGGLLFSGMLAWNLARPLSQLRASFERVAQGDLSVRLYPSMRRRHDEIGDVARDF
DAMVGRLSVLVSAREQLLHDVSHELRSPLARLQLAIGLARQNPDNVENALQRIEREAERM
DKMIGEVLTLSRAENDAVNNEEYFDLLGLVNAVVNDARYEAQVPGVDIALNISDYDDYTV
KGSAELMRHALDNIIRNALRFSSRGQQVLVTLSRDEKNWCIGVADRGPGVEESKLSSIFD
PFMRIDSPQSGKGYGLGLAIARKAVVAHGGRIEAENRDQGGLQIRICIPRWR