Protein Info for DZA65_RS04320 in Dickeya dianthicola ME23

Annotation: MacB family efflux pump subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 transmembrane" amino acids 273 to 294 (22 residues), see Phobius details amino acids 522 to 548 (27 residues), see Phobius details amino acids 573 to 599 (27 residues), see Phobius details amino acids 608 to 631 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 113 bits, see alignment E=2.7e-36 PF12704: MacB_PCD" amino acids 273 to 492 (220 residues), 145.3 bits, see alignment E=4.6e-46 PF02687: FtsX" amino acids 528 to 641 (114 residues), 66.4 bits, see alignment E=3.8e-22

Best Hits

Swiss-Prot: 71% identical to MACB_PECAS: Macrolide export ATP-binding/permease protein MacB (macB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 93% identity to ddd:Dda3937_01419)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTP5 at UniProt or InterPro

Protein Sequence (648 amino acids)

>DZA65_RS04320 MacB family efflux pump subunit (Dickeya dianthicola ME23)
MSAPLLALRRLHRRFTNGEQRVDVLKNINLTIHAGEMVAIIGASGSGKSTLMNILGCLDK
PTQGDYQVAGVSTLTLNADQLAALRREHFGFIFQRYHLLNDLNVGDNVEMPAVYAGQARH
ERRRRAAALLARLGLAERLQDSPSQLSGGQQQRVSIARALINGGQVILADEPTGALDSVS
GEEVLSILRELHQQGHTIVLVTHDSRIAQMAGRIIEIHDGEIVADRHTAADMTPARPTPP
AVPPAKTLTREYDRLQNAFRMALRAMSAQRIRTFLTMLGIIIGIASVVSVVALGKGSQQQ
MLEHINAMGTSTLEIFSGKDFGDMHSAAIQTLRVNDLRPLEQQPYIHSVTPTVSTSATLR
YANKAVSVSVSGVGEQFFTVRGYVLSEGNGFSPLSVERLTQEAVIDQNTRNKLFPNGENP
LGQVIFLGQLPCRIIGVATRKQSGFGSDENLNVWVPYTTVMRRMVGQSYLRSITVRVKDN
IDLSVAQQGITQILTRQHGNKDFFVMNTDSIRQTIRQTTATMTLLVSAIALISLIVGGIG
VMNIMLVSVTERTREIGVRMAVGARTGDIMQQFLIEAVLVCLCGGILGVILSLLAGAIAS
RISGVTFVYSAPVMALAFFCSSLIGVIFGFFPARRAARLQPIHALERE