Protein Info for DZA65_RS04275 in Dickeya dianthicola ME23

Annotation: oxygen-dependent coproporphyrinogen oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF01218: Coprogen_oxidas" amino acids 9 to 301 (293 residues), 441.8 bits, see alignment E=4e-137

Best Hits

Swiss-Prot: 81% identical to HEM6_PECAS: Oxygen-dependent coproporphyrinogen-III oxidase (hemF) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00228, coproporphyrinogen III oxidase [EC: 1.3.3.3] (inferred from 97% identity to ddd:Dda3937_01401)

MetaCyc: 76% identical to coproporphyrinogen III oxidase (Escherichia coli K-12 substr. MG1655)
Coproporphyrinogen oxidase. [EC: 1.3.3.3]

Predicted SEED Role

"Coproporphyrinogen III oxidase, aerobic (EC 1.3.3.3)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DPS0 at UniProt or InterPro

Protein Sequence (312 amino acids)

>DZA65_RS04275 oxygen-dependent coproporphyrinogen oxidase (Dickeya dianthicola ME23)
MSSPDINAIKHFLLTLQDNLCRQFELTDGTATFIEDAWQHASGGGGRSRVLRQGQVFEQA
GVNFSHVSGTSLPPSASTHRPELAGRSFQAMGVSLVVHPLNPYVPTSHANIRFFIAEKPG
EPAVWWFGGGFDLTPYYGFEEDAVHWHQTAFDLCKPFGDDVYPRYKQWCDDYFVLKHRNE
ARGVGGLFFDDLNTPDFDASFAFMRAVGEGFRHAYLPIVNRRKDIPWGERERQFQLYRRG
RYVEFNLVWDRGTLFGLQSGGRTESILMSLPPLVRWEYQYQPEPDSPEAALYRDFLPARD
WLGLNTPSGARG