Protein Info for DZA65_RS04175 in Dickeya dianthicola ME23

Annotation: tail protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF12571: DUF3751" amino acids 3 to 159 (157 residues), 120.3 bits, see alignment E=7.2e-39 PF07484: Collar" amino acids 336 to 383 (48 residues), 47.7 bits, see alignment 1.2e-16

Best Hits

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_02557)

Predicted SEED Role

"Phage tail fiber protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XX34 at UniProt or InterPro

Protein Sequence (473 amino acids)

>DZA65_RS04175 tail protein (Dickeya dianthicola ME23)
MAQSVITHAFETWNVQRVLDGTAARPDQVVFARVPGQDESVPVDRNEGLPPADQIQHTAA
ITQAGVLNENAVVYSVVLDTTVGDWDYNWIGLLDSKTNTVLMIVHVRTQQKLATRNGQQG
NSLTRNLMMQFDGAAAATQINVTADTWQIDFSARLAGIDERIRIENMDRYGSSAFFGNAY
QVVKDGNAYVVKAGVAYAAGLRAWLSSDLKITVDALPTRVFLDVCWRGEFTQAWAVDSQI
VVANSADHEIRDGVQHYLLPVADIDENGNITDWRKQGSLAEQNAQTLYLRKDDNLAALRD
KEASRKNLGLGQLAVMDTDTARQTLRITQLENELVGIPLPYPGATAPDGWLKCNGQSFNK
SMYPLLAGRYLSGFLPDLRGEFIRGWDDGRGVDAGRSLLSAQTQTVQDHKHVGTMVNSNP
LQTGMNTGIGLLSQYTSTPTVGYSNEISSGGTAEGSKETRPRNVAFNYIVRAA