Protein Info for DZA65_RS04120 in Dickeya dianthicola ME23

Annotation: DUF2597 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF10772: Phage_HP1_Orf24" amino acids 8 to 141 (134 residues), 232.7 bits, see alignment E=6.3e-74

Best Hits

Swiss-Prot: 55% identical to YO24_BPHC1: Putative tail tube protein from Haemophilus phage HP1 (strain HP1c1)

KEGG orthology group: None (inferred from 99% identity to ddc:Dd586_0750)

Predicted SEED Role

"FIG01221496: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CAE3 at UniProt or InterPro

Protein Sequence (151 amino acids)

>DZA65_RS04120 DUF2597 family protein (Dickeya dianthicola ME23)
MTKRISGQSFDFNMDGALVHAEKVSLSITDNTAAAQTQGIPDGWVAGDVAAEGEMELSTK
SLAVVTAKASSAGSWRGIDPVDLMWYAKAGSEEMKVEAFGCKLILSDILDVDPKGGSVMS
HKIKFVVTSPDFVRINGIPYLESELTEKLIG