Protein Info for DZA65_RS04005 in Dickeya dianthicola ME23

Annotation: site-specific integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF24624: Int_N" amino acids 57 to 167 (111 residues), 90.4 bits, see alignment E=1.1e-29 PF00589: Phage_integrase" amino acids 175 to 322 (148 residues), 75 bits, see alignment E=6.3e-25

Best Hits

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_01762)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D9I6 at UniProt or InterPro

Protein Sequence (363 amino acids)

>DZA65_RS04005 site-specific integrase (Dickeya dianthicola ME23)
MAVRKLASGKWLCECYPFGREGKRVRKQFATKGEALAFERFTMEESENKPWLGEKADNRS
LREIIDLWFSLYGRTLADPKRMMAKLDIICTGLGNPKARELSAADFAHYRELRLAGQMTD
ASGIPLSVVKPRTVNLEQRNLSAVFGTLKKLGHWDAPNPLSGLPTFKIAQQELAFLAPNE
IKRVLDACAESANPHLLLVTKICLATGARWSEAEGLSGQQVTPYRITYTRTKGKKNRTVP
ISRELYDEIPRKSGKLFSPCRKTFERAINRTGIQLPDGQCTHVLRHTFASHFMMNGGNIL
VLRDILGHADIKMTMIYAHFAPDHLEDAITKNPLNGLNWSPKNGGKLAAANGNQAFSSPL
ITK