Protein Info for DZA65_RS03910 in Dickeya dianthicola ME23
Annotation: lytic murein transglycosylase B
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 69% identical to MLTB_ECOLI: Membrane-bound lytic murein transglycosylase B (mltB) from Escherichia coli (strain K12)
KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 97% identity to ddd:Dda3937_01212)MetaCyc: 69% identical to membrane-bound lytic murein transglycosylase B (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]; 4.2.2.f [EC: 4.2.2.f]
Predicted SEED Role
"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)
MetaCyc Pathways
- peptidoglycan recycling I (13/14 steps found)
- peptidoglycan recycling II (6/10 steps found)
KEGG Metabolic Maps
- Ascorbate and aldarate metabolism
- Glycosaminoglycan degradation
- Nucleotide sugars metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 3.2.1.-
Use Curated BLAST to search for 3.2.1.- or 4.2.2.f
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385XTN9 at UniProt or InterPro
Protein Sequence (367 amino acids)
>DZA65_RS03910 lytic murein transglycosylase B (Dickeya dianthicola ME23) MRRLVAVFPLLLALSACSNKSTEPAGAEIIGTPAANAPSGGFLLSPAHAGGLLTSGDFAN SPEVDRFVDKMVRQYGFERQQLHDVLAQAQRLDWVIRLMDKQAPSPSTSTPSNIPNGAWL RYRKQFITPDNVQNGVAFWNQYQDALDRARQVYGVPPEIIVGIIGVETRWGRVMGKTRIL DALATLAFAYPRRAEYFQSELEYFLLMAREDGFDPLSLRGSFAGAMGYGQFMPSAFKKYA VDFNGDGIANLWDPVDAIGSVANYFKSNGWQPDGQVAVTASGQTFALETGFKTRYSLSTL AAAGLRPSAALGGVQEASLLRLDMGSYYQFWYGLPNFYAITRYNHSVHYAMAVWQLGEEV RKARQGY