Protein Info for DZA65_RS03885 in Dickeya dianthicola ME23

Annotation: Gfo/Idh/MocA family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF01408: GFO_IDH_MocA" amino acids 4 to 130 (127 residues), 91.1 bits, see alignment E=1.7e-29 PF03447: NAD_binding_3" amino acids 43 to 128 (86 residues), 27 bits, see alignment E=1.3e-09 PF22725: GFO_IDH_MocA_C3" amino acids 139 to 274 (136 residues), 104.9 bits, see alignment E=6e-34 PF02894: GFO_IDH_MocA_C" amino acids 142 to 373 (232 residues), 80.9 bits, see alignment E=2.5e-26

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddc:Dd586_0712)

Predicted SEED Role

"Myo-inositol 2-dehydrogenase 2 (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XU90 at UniProt or InterPro

Protein Sequence (377 amino acids)

>DZA65_RS03885 Gfo/Idh/MocA family oxidoreductase (Dickeya dianthicola ME23)
MKQVRIGLIGTGYIGRAHAIAYAQAPVVYALKGQLVREMLAEVSPELARQRARELGFARF
TNDWQELVADPAIDVVDICAPNFLHQSMAMAAIRHGKHVYSEKPLALNAAEARAMVDAAR
RAGVKTLVGFNYMKNPAAQLAKEIIARGEIGEVTHFYGAHNEDYLADPLKPADWHCFRHT
AGLGALGDVGAHIVNMAHYLVGEITEVCGDLQTVVPQRPVSAGSADRVAVENEDQAHAMV
RFASGARGVIEASRVACGRKMGLSYVITGTRGAISFTQERMAELKLYRHDDPVNRQGFQT
LLIGPQHPEYAAFCASAGHGVGFNDQKTVEVRDLVDGIAADQPLWPDFEEGWRVSRVLDA
IVLSHQAARWVAVHEVG